PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0285s0015.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family HB-other
Protein Properties Length: 296aa    MW: 33068.2 Da    PI: 7.8417
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0285s0015.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.25.8e-182174457
                          -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
              Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                          R++ ++ ql  Le++++ ++yps+e r++L+kk+gL+e+q +vWF+ rR k+++
  Sphfalx0285s0015.1.p 21 RRKKSPLQLGLLEKVYADDKYPSEEVRTDLSKKIGLSEKQLQVWFKHRRHKDRR 74
                          88999***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.27E-15974IPR009057Homeodomain-like
PROSITE profilePS5007116.2441575IPR001356Homeobox domain
SMARTSM003893.3E-171779IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-162174IPR009057Homeodomain-like
PfamPF000462.2E-152174IPR001356Homeobox domain
CDDcd000861.97E-162174No hitNo description
PROSITE patternPS0002705073IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MASDDSSPEQ SPEKQQKGIA RRKKSPLQLG LLEKVYADDK YPSEEVRTDL SKKIGLSEKQ  60
LQVWFKHRRH KDRRDGIDDD KLTLYASRHK ADADSEELPS TKRGEIDLNS REDDKSEDGY  120
PAAVLAEEQD DDVLIVNKMN GIDVNEGDFE EFEKPKATTK KKIASGLKEQ PRKPPLKPTS  180
LKSKVISKVD ALELAAVKAV ESQLNGPLRE DGPPLGFEFD SPPPGAFEEF MSTEGPYRAN  240
VRHEHRFKSL NGRAALEGKW GKDSVSLEKK KRKLGDLYGA RLPAGQPVYR GGFQL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16774RRHKDRRD
2268273KKKRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.11e-27homeobox-1